SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23111032|ref|NP_683758.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23111032|ref|NP_683758.1|
Domain Number 1 Region: 90-204
Classification Level Classification E-value
Superfamily PX domain 4.19e-29
Family PX domain 0.0011
Further Details:      
 
Domain Number 2 Region: 244-455
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000151
Family IMD domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|23111032|ref|NP_683758.1|
Sequence length 457
Comment sorting nexin-1 isoform b [Homo sapiens]
Sequence
MASGGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPK
ITTSLLPINNGSKENGIHEEQDQEPQDLFAGDGMNAYVAYKVTTQTSLPLFRSKQFAVKR
RFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERY
LQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLSGAGLLKMFNKATDAVSKMTIKMNES
DIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKSLAMLGSSEDNTALSR
ALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRWQDAQA
TLQKKREAEARLLWANKPDKLQQAKDEILEWESRVTQYERDFERISTVVRKEVIRFEKEK
SKDFKNHVIKYLETLLYSQQQLAKYWEAFLPEAKAIS
Download sequence
Identical sequences A0A2I3SI77
ENSP00000453567 NP_683758.1.87134 NP_683758.1.92137 gi|23111032|ref|NP_683758.1| ENSP00000453567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]