SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23238244|ref|NP_071416.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23238244|ref|NP_071416.2|
Domain Number 1 Region: 95-217
Classification Level Classification E-value
Superfamily PX domain 2.49e-30
Family PX domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|23238244|ref|NP_071416.2|
Sequence length 344
Comment sorting nexin-16 isoform a [Homo sapiens]
Sequence
MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQ
MDNTSSVCSSPLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEE
RAKFTVYKILVKKTPEESWVVFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADF
LEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRL
QKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPEESLDVSETEGEQILKVESSA
LEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED
Download sequence
Identical sequences P57768
NP_071416.2.87134 NP_071416.2.92137 NP_690049.1.87134 NP_690049.1.92137 ENSP00000322652 ENSP00000379621 ENSP00000322652 ENSP00000379621 gi|23238244|ref|NP_071416.2| gi|23238246|ref|NP_690049.1| 9606.ENSP00000322652 ENSP00000322652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]