SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23510400|ref|NP_683878.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23510400|ref|NP_683878.1|
Domain Number 1 Region: 354-375,406-590
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.4e-76
Family Fumble-like 0.0000000166
Further Details:      
 
Domain Number 2 Region: 236-380
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.75e-45
Family Fumble-like 0.0000000921
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|23510400|ref|NP_683878.1|
Sequence length 598
Comment pantothenate kinase 1 isoform alpha [Homo sapiens]
Sequence
MLKLVGGGGGQDWACSVAGTSLGGEEAAFEVARPGDQGKAGGGSPGWGCAGIPDSAPGAG
VLQAGAVGPARGGQGAEEVGESAGGGEERRVRHPQAPALRLLNRKPQGGSGEIKTPENDL
QRGRLSRGPRTAPPAPGMGDRSGQQERSVPHSPGAPVGTSAAAVNGLLHNGFHPPPVQPP
HVCSRGPVGGSDAAPQRLPLLPELQPQPLLPQHDSPAKKCRLRRRMDSGRKNRPPFPWFG
MDIGGTLVKLVYFEPKDITAEEEQEEVENLKSIRKYLTSNTAYGKTGIRDVHLELKNLTM
CGRKGNLHFIRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDFRMIADLQLHK
LDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVS
ILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYG
GDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENID
RVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALLELFKMTDDK
Download sequence
Identical sequences Q8TE04
NP_683878.1.87134 NP_683878.1.92137 gi|23510400|ref|NP_683878.1| 9606.ENSP00000302108 ENSP00000302108 ENSP00000302108 ENSP00000345118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]