SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23510402|ref|NP_683879.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23510402|ref|NP_683879.1|
Domain Number 1 Region: 129-150,181-365
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.32e-76
Family Fumble-like 0.0000000166
Further Details:      
 
Domain Number 2 Region: 11-155
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.12e-46
Family Fumble-like 0.0000000921
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|23510402|ref|NP_683879.1|
Sequence length 373
Comment pantothenate kinase 1 isoform beta [Homo sapiens]
Sequence
MKLINGKKQTFPWFGMDIGGTLVKLVYFEPKDITAEEEQEEVENLKSIRKYLTSNTAYGK
TGIRDVHLELKNLTMCGRKGNLHFIRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFK
FEEDFRMIADLQLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLD
NPYPMLLVNMGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAK
GDSTNVDKLVKDIYGGDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNN
IGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAV
GALLELFKMTDDK
Download sequence
Identical sequences A0A2J8PEC6 A0A2J8WQK2 A0A2K5DGR4 G3RXB0
9600.ENSPPYP00000002860 ENSP00000345118 gi|23510402|ref|NP_683879.1| NP_683879.1.87134 NP_683879.1.92137 XP_003312808.1.37143 XP_004049821.1.27298 XP_008948923.1.60992 XP_012310172.1.9421 ENSP00000345118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]