SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23510462|ref|NP_690051.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23510462|ref|NP_690051.1|
Domain Number 1 Region: 424-518
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.44e-21
Family Canonical RBD 0.00000253
Further Details:      
 
Domain Number 2 Region: 547-631,853-929
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.2e-20
Family Canonical RBD 0.0000147
Further Details:      
 
Domain Number 3 Region: 296-385
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.49e-16
Family Canonical RBD 0.0034
Further Details:      
 
Domain Number 4 Region: 4-87
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000339
Family Canonical RBD 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|23510462|ref|NP_690051.1|
Sequence length 932
Comment RNA-binding protein 12 [Homo sapiens]
Sequence
MAVVIRLQGLPIVAGTMDIRHFFSGLTIPDGGVHIVGGELGEAFIVFATDEDARLGMMRT
GGTIKGSKVTLLLSSKTEMQNMIELSRRRFETANLDIPPANASRSGPPPSSGMSSRVNLP
TTVSNFNNPSPSVVTATTSVHESNKNIQTFSTASVGTAPPNMGASFGSPTFSSTVPSTAS
PMNTVPPPPIPPIPAMPSLPPMPSIPPIPVPPPVPTLPPVPPVPPIPPVPSVPPMTPLPP
MSGMPPLNPPPVAPLPAGMNGSGAPMNLNNNLNPMFLGPLNPVNPIQMNSQSSVKPLPIN
PDDLYVSVHGMPFSAMENDVRDFFHGLRVDAVHLLKDHVGRNNGNGLVKFLSPQDTFEAL
KRNRMLMIQRYVEVSPATERQWVAAGGHITFKQNMGPSGQTHPPPQTLPRSKSPSGQKRS
RSRSPHEAGFCVYLKGLPFEAENKHVIDFFKKLDIVEDSIYIAYGPNGKATGEGFVEFRN
EADYKAALCRHKQYMGNRFIQVHPITKKGMLEKIDMIRKRLQNFSYDQREMILNPEGDVN
SAKVCAHITNIPFSITKMDVLQFLEGIPVDENAVHVLVDNNGQGLGQALVQFKNEDDARK
SERLHRKKLNGREAFVHVVTLEDMREIEKNPPAQGKKGLKMPVPGNPAVPGMPNAGLPGV
GLPSAGLPGAGLPSTGLPGSAITSAGLPGAGMPSAGIPSAGGEEHAFLTVGSKEANNGPP
FNFPGNFGGSNAFGPPIPPPGLGGGAFGDARPGMPSVGNSGLPGLGLDVPGFGGGPNNLS
GPSGFGGGPQNFGNGPGSLGGPPGFGSGPPGLGSAPGHLGGPPAFGPGPGPGPGPGPIHI
GGPPGFASSSGKPGPTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEA
MVAFESRDEATAAVIDLNDRPIGSRKVKLVLG
Download sequence
Identical sequences K7CH85 Q9NTZ6
ENSPTRP00000023069 gi|19923345|ref|NP_006038.2| gi|23510462|ref|NP_690051.1| gi|311893287|ref|NP_001185767.1| gi|312032348|ref|NP_001185769.1| ENSPTRP00000023069 NP_001185767.1.87134 NP_001185767.1.92137 NP_001185769.1.87134 NP_001185769.1.92137 NP_001238775.1.37143 NP_006038.2.87134 NP_006038.2.92137 NP_690051.1.87134 NP_690051.1.92137 XP_008955481.1.60992 XP_008955482.1.60992 XP_008955483.1.60992 XP_014198499.1.60992 XP_014198500.1.60992 XP_016793279.1.37143 XP_016793280.1.37143 XP_016793282.1.37143 XP_016793283.1.37143 XP_016793284.1.37143 XP_016793285.1.37143 XP_016802587.1.37143 XP_016802588.1.37143 XP_016802589.1.37143 XP_016802590.1.37143 ENSP00000352668 9598.ENSPTRP00000023069 9606.ENSP00000352668 ENSP00000352668 ENSP00000363217 ENSP00000363228 ENSP00000352668 ENSP00000363217 ENSP00000363228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]