SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|238814385|ref|NP_006615.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238814385|ref|NP_006615.2|
Domain Number 1 Region: 270-392
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.29e-24
Family PWWP domain 0.008
Further Details:      
 
Domain Number 2 Region: 134-263
Classification Level Classification E-value
Superfamily Bromodomain 1.3e-17
Family Bromodomain 0.0026
Further Details:      
 
Domain Number 3 Region: 86-151
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000142
Family PHD domain 0.015
Further Details:      
 
Domain Number 4 Region: 557-600
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000113
Family MYND zinc finger 0.013
Further Details:      
 
Weak hits

Sequence:  gi|238814385|ref|NP_006615.2|
Domain Number - Region: 463-528
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0349
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238814385|ref|NP_006615.2|
Sequence length 602
Comment zinc finger MYND domain-containing protein 11 isoform a [Homo sapiens]
Sequence
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAV
KDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFR
VYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADI
ARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEEPEPETEAVSS
SQEIPTMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKIFNDFKD
RMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFV
EEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRR
KR
Download sequence
Identical sequences G1RSF2 G3RK76 H2N9K3 K7CUR4 Q15326
NP_006615.2.87134 NP_006615.2.92137 XP_001136274.1.37143 XP_003280278.1.23891 XP_003827801.1.60992 XP_003827802.1.60992 XP_004049019.1.27298 XP_005252416.1.92137 XP_008951324.1.60992 XP_009456098.1.37143 XP_009456099.1.37143 XP_009456101.1.37143 XP_012355010.1.23891 XP_012355011.1.23891 XP_016818010.1.37143 XP_016871076.1.92137 XP_016871077.1.92137 XP_016871078.1.92137 XP_016871079.1.92137 XP_018890826.1.27298 XP_018890828.1.27298 ENSP00000371003 ENSP00000381053 ENSP00000457248 ENSNLEP00000016175 ENSPPYP00000002349 ENSP00000370996 ENSP00000455330 ENSGGOP00000016136 gi|238814385|ref|NP_006615.2| ENSNLEP00000016175 ENSPPYP00000002349 ENSGGOP00000016136 ENSP00000371003 ENSP00000381053 9598.ENSPTRP00000003768 9600.ENSPPYP00000002349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]