SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23943872|ref|NP_073570.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23943872|ref|NP_073570.1|
Domain Number 1 Region: 12-125
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.55e-44
Family Pyk2-associated protein beta ARF-GAP domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|23943872|ref|NP_073570.1|
Sequence length 429
Comment stromal membrane-associated protein 2 isoform 1 [Homo sapiens]
Sequence
MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGV
HISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEK
KKYMDRSLDINAFRKEKDDKWKRGSEPVPEKKLEPVVFEKVKMPQKKEDPQLPRKSSPKS
TAPVMDLLGLDAPVACSIANSKTSNTLEKDLDLLASVPSPSSSGSRKVVGSMPTAGSAGS
VPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQTPQMPTQAMFMAPAQMAYPTAYPSF
PGVTPPNSIMGSMMPPPVGMVAQPGASGMVAPMAMPAGYMGGMQASMMGVPNGMMTTQQA
GYMAGMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMSGGNGQAAN
QTLSPQMWK
Download sequence
Identical sequences A0A2I3SNP0 G3QN37 Q8WU79
ENSP00000361803 ENSPTRP00000001020 ENSPTRP00000001020 NP_073570.1.87134 NP_073570.1.92137 XP_004025585.1.27298 XP_016815350.1.37143 9598.ENSPTRP00000001020 9606.ENSP00000361803 ENSP00000361803 ENSGGOP00000003942 gi|23943872|ref|NP_073570.1| ENSP00000361803 ENSGGOP00000003942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]