SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23957702|ref|NP_705837.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23957702|ref|NP_705837.1|
Domain Number 1 Region: 558-810
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.42e-89
Family Eukaryotic proteases 0.0000994
Further Details:      
 
Domain Number 2 Region: 345-449
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000301
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 3 Region: 85-170
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000034
Family SEA domain 0.0063
Further Details:      
 
Domain Number 4 Region: 494-525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 530-569
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000367
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 243-327
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000209
Family Spermadhesin, CUB domain 0.0062
Further Details:      
 
Domain Number 7 Region: 459-491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000249
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|23957702|ref|NP_705837.1|
Sequence length 811
Comment transmembrane protease serine 6 [Homo sapiens]
Sequence
MLLLFHSKRMPVAEAPQVAGGQGDGGDGEEAEPEGMFKACEDSKRKARGYLRLVPLFVLL
ALLVLASAGVLLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK
MLKELITSTRLGTYYNSSSVYSFGEGPLTCFFWFILQIPEHRRLMLSPEVVQALLVEELL
STVNSSAAVPYRAEYEVDPEGLVILEASVKDIAALNSTLGCYRYSYVGQGQVLRLKGPDH
LASSCLWHLQGPKDLMLKLRLEWTLAECRDRLAMYDVAGPLEKRLITSVYGCSRQEPVVE
VLASGAIMAVVWKKGLHSYYDPFVLSVQPVVFQACEVNLTLDNRLDSQGVLSTPYFPSYY
SPQTHCSWHLTVPSLDYGLALWFDAYALRRQKYDLPCTQGQWTIQNRRLCGLRILQPYAE
RIPVVATAGITINFTSQISLTGPGVRVHYGLYNQSDPCPGEFLCSVNGLCVPACDGVKDC
PNGLDERNCVCRATFQCKEDSTCISLPKVCDGQPDCLNGSDEEQCQEGVPCGTFTFQCED
RSCVKKPNPQCDGRPDCRDGSDEEHCDCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRH
ICGGALIADRWVITAAHCFQEDSMASTVLWTVFLGKVWQNSRWPGEVSFKVSRLLLHPYH
EEDSHDYDVALLQLDHPVVRSAAVRPVCLPARSHFFEPGLHCWITGWGALREGGPISNAL
QKVDVQLIPQDLCSEVYRYQVTPRMLCAGYRKGKKDACQGDSGGPLVCKALSGRWFLAGL
VSWGLGCGRPNYFGVYTRITGVISWIQQVVT
Download sequence
Identical sequences Q8IU80
9606.ENSP00000334962 NYSGRC-23957702 gi|23957702|ref|NP_705837.1| ENSP00000334962 ENSP00000334962 NP_705837.1.87134 NP_705837.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]