SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|239745058|ref|XP_002343353.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239745058|ref|XP_002343353.1|
Domain Number 1 Region: 87-323
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.89e-61
Family Ankyrin repeat 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|239745058|ref|XP_002343353.1|
Sequence length 544
Comment PREDICTED: POTE ankyrin domain family member B-like isoform 1 [Homo sapiens]
Sequence
MVAEVCSMPAASAVKKPFDLRSKMGKWCHHRFPCCRGSGTSNVGTSGDHDDSFMKTLRSK
MGKWCCHCFPCCRGSGKSNVGTWGDYDDSAFMEPRYHVRREDLDKLHRAAWWGKVPRKDL
IVMLRDTDMNKRDKQKRTALHLASANGNSEVVQLLLDRRCQLNVLDNKKRTALIKAVQCQ
EDECVLMLLEHGADGNIQDEYGNTALHYAIYNEDKLMAKALLLYGADIESKNKCGLTPLL
LGVHEQKQEVVKFLIKKKANLNALDRYGRTALILAVCCGSASIVNLLLEQNVDVSSQDLS
GQTAREYAVSSHHHVICELLSDYKEKQMLKISSENSNPEQDLKLTSEEESQRLKVSENSQ
PEKMSQEPEINKDCDREVEEEIKKHGSNPVGLPENLTNGASAGNGDDGLIPQRKSRKPEN
QQFPDTENEEYHSDEQNDTQKQLSEEQNTGISQDEILTNKQKQIEVAEKEMNSELSLSHK
KEEDLLRENSMLREEIAKLRLELDETKHQNQLRENKILEEIESVKEKLLKTIQLNEEALT
KTSI
Download sequence
Identical sequences A0A0A6YYL3 H3BUK9
NP_001264232.1.92137 NP_001264233.1.92137 ENSP00000454944 ENSP00000457443 9606.ENSP00000411620 9606.ENSP00000413654 ENSP00000456953 ENSP00000457689 gi|239745058|ref|XP_002343353.1| gi|341915688|ref|XP_003403587.1| ENSP00000456953 ENSP00000457689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]