SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|239787919|ref|NP_116221.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239787919|ref|NP_116221.3|
Domain Number 1 Region: 208-298
Classification Level Classification E-value
Superfamily PKD domain 0.00000000484
Family PKD domain 0.0084
Further Details:      
 
Domain Number 2 Region: 308-345
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|239787919|ref|NP_116221.3|
Sequence length 500
Comment low-density lipoprotein receptor-related protein 11 precursor [Homo sapiens]
Sequence
MASVAQESAGSQRRLPPRHGALRGLLLLCLWLPSGRAALPPAAPLSELHAQLSGVEQLLE
EFRRQLQQERPQEELELELRAGGGPQEDCPGPGSGGYSAMPDAIIRTKDSLAAGASFLRA
PAAVRGWRQCVAACCSEPRCSVAVVELPRRPAPPAAVLGCYLFNCTARGRNVCKFALHSG
YSSYSLSRAPDGAALATARASPRQEKDAPPLSKAGQDVVLHLPTDGVVLDGRESTDDHAI
VQYEWALLQGDPSVDMKVPQSGTLKLSHLQEGTYTFQLTVTDTAGQRSSDNVSVTVLRAA
YSTGGCLHTCSRYHFFCDDGCCIDITLACDGVQQCPDGSDEDFCQNLGLDRKMVTHTAAS
PALPRTTGPSEDAGGDSLVEKSQKATAPNKPPALSNTEKRNHSAFWGPESQIIPVMPDSS
SSGKNRKEESYIFESKGDGGGGEHPAPETGAVLPLALGLAITALLLLMVACRLRLVKQKL
KKARPITSEESDYLINGMYL
Download sequence
Identical sequences Q86VZ4
NP_116221.3.87134 NP_116221.3.92137 ENSP00000239367 gi|239787919|ref|NP_116221.3| 9606.ENSP00000239367 ENSP00000239367 ENSP00000239367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]