SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|24041035|ref|NP_077719.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24041035|ref|NP_077719.2|
Domain Number 1 Region: 1820-2066
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.13e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 911-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000554
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 3 Region: 594-725
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000199
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 782-915
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000659
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 413-536
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000816
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 1174-1308
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000879
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 948-991
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000402
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 8 Region: 1013-1153
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000408
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 9 Region: 532-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000697
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 10 Region: 757-793
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000164
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 11 Region: 325-461
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000518
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 12 Region: 146-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000128
Family EGF-type module 0.016
Further Details:      
 
Domain Number 13 Region: 260-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000368
Family EGF-type module 0.019
Further Details:      
 
Domain Number 14 Region: 181-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000214
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 15 Region: 65-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000261
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 16 Region: 222-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 17 Region: 716-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000589
Family EGF-type module 0.015
Further Details:      
 
Domain Number 18 Region: 1305-1344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000911
Family EGF-type module 0.014
Further Details:      
 
Domain Number 19 Region: 1424-1456
Classification Level Classification E-value
Superfamily Notch domain 0.000000102
Family Notch domain 0.0015
Further Details:      
 
Domain Number 20 Region: 1377-1415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 21 Region: 108-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000304
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 22 Region: 1503-1534
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0034
Further Details:      
 
Domain Number 23 Region: 27-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000952
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  gi|24041035|ref|NP_077719.2|
Domain Number - Region: 987-1018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00101
Family EGF-type module 0.0073
Further Details:      
 
Domain Number - Region: 1466-1497
Classification Level Classification E-value
Superfamily Notch domain 0.00131
Family Notch domain 0.0086
Further Details:      
 
Domain Number - Region: 1153-1181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|24041035|ref|NP_077719.2|
Sequence length 2471
Comment neurogenic locus notch homolog protein 2 isoform 1 preproprotein [Homo sapiens]
Sequence
MPALRPALLWALLALWLCCAAPAHALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGT
CHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCE
TDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTG
DFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIHGICM
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGS
FCLHEINECSSHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQ
KKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLG
YTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPSPRDCESGCAS
SPCQHGGSCHPQRQPPYYSCQCAPPFSGSRCELYTAPPSTPPATCLSQYCADKARDGVCD
EACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTVECLFDNFECQGNS
KTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQ
DARSFLRALGTLLHTNLRIKRDSQGELMVYPYYGEKSAAMKKQRMTRRSLPGEQEQEVAG
SKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPERTQLLY
LLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNL
SVQVSEANLIGTGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG
KKSRRPSAKSTMPTSLPNLAKEAKDAKGSRRKKSLSEKVQLSESSVTLSPVDSLESPHTY
VSDTTSSPMITSPGILQASPNPMLATAAPPAPVHAQHALSFSNLHEMQPLAHGASTVLPS
VSQLLSHHHIVSPGSGSAGSLSRLHPVPVPADWMNRMEVNETQYNEMFGMVLAPAEGTHP
GIAPQSRPPEGKHITTPREPLPPIVTFQLIPKGSIAQPAGAPQPQSTCPPAVAGPLPTMY
QIPEMARLPSVAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAER
TPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHMS
EPPHNNMQVYA
Download sequence
Identical sequences Q04721
gi|24041035|ref|NP_077719.2| NP_077719.2.87134 NP_077719.2.92137 ENSP00000256646 ENSP00000464488 ENSP00000256646 9606.ENSP00000256646 ENSP00000256646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]