SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|24234686|ref|NP_694881.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24234686|ref|NP_694881.1|
Domain Number 1 Region: 5-187
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.21e-73
Family Actin/HSP70 0.0000000134
Further Details:      
 
Domain Number 2 Region: 192-382
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.47e-70
Family Actin/HSP70 0.0000000136
Further Details:      
 
Domain Number 3 Region: 386-467
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 1.1e-32
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.00000718
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|24234686|ref|NP_694881.1|
Sequence length 493
Comment heat shock cognate 71 kDa protein isoform 2 [Homo sapiens]
Sequence
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGMPGGMPGGFPGGGAPPS
GGASSGPTIEEVD
Download sequence
Identical sequences A0A1D5R5R1 A0A2I2ZFC3 A0A2I3HBS4 A0A2I3T323 A0A2J8X0A0 A0A2K5EK57 A0A2K5H9I4 A0A2K5WNP5 A0A2K5YIT7 A0A2K6D6M6 A0A2K6UPA3
gi|24234686|ref|NP_694881.1| NP_694881.1.87134 NP_694881.1.92137 XP_003253351.1.23891 XP_004667403.1.11716 XP_006833992.1.41390 XP_007948136.1.48129 XP_011782386.1.43180 XP_011820387.1.47321 ENSP00000404372 ENSP00000404372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]