SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|24308163|ref|NP_061178.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24308163|ref|NP_061178.1|
Domain Number 1 Region: 5-236
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.41e-50
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 530-620
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-19
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 3 Region: 300-333,379-436
Classification Level Classification E-value
Superfamily TPR-like 0.0000338
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|24308163|ref|NP_061178.1|
Sequence length 669
Comment protein fem-1 homolog A [Homo sapiens]
Sequence
MDLRTAVYNAARDGKLQLLQKLLSGRSREELDELTGEVAGGGTPLLIAARYGHLDVVEYL
VDRCGASVEAGGSVHFDGETIEGAPPLWAASAAGHLDVVRSLLRRGASVNRTTRTNSTPL
RAACFDGHLEVVRYLVGEHQADLEVANRHGHTCLMISCYKGHREIARYLLEQGAQVNRRS
AKGNTALHDCAESGSLEILQLLLGCKARMERDGYGMTPLLAASVTGHTNIVEYLIQEQPG
QEQVAGGEAQPGLPQEDPSTSQGCAQPQGAPCCSSSPEEPLNGESYESCCPTSREAAVEA
LELLGATYVDKKRDLLGALKHWRRAMELRHQGGEYLPKPEPPQLVLAYDYSREVNTTEEL
EALITDPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFERCIRLWKYALDMQ
QSNLEPLSPMTASSFLSFAELFSYVLQDRAAKGSLGTQIGFADLMGVLTKGVREVERALQ
LPREPGDSAQFTKALAIILHLLYLLEKVECTPSQEHLKHQTVYRLLKCAPRGKNGFTPLH
MAVDKDTTNVGRYPVGRFPSLHVVKVLLDCGADPDSRDFDNNTPLHIAAQNNCPAIMNAL
IEAGAHMDATNAFKKTAYELLDEKLLARGTMQPFNYVTLQCLAARALDKNKIPYKGFIPE
DLEAFIELH
Download sequence
Identical sequences Q9BSK4
ENSP00000269856 ENSP00000269856 gi|24308163|ref|NP_061178.1| NP_061178.1.87134 NP_061178.1.92137 ENSP00000269856 9606.ENSP00000269856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]