SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|24308458|ref|NP_714924.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24308458|ref|NP_714924.1|
Domain Number 1 Region: 79-172
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000198
Family Double-stranded RNA-binding domain (dsRBD) 0.015
Further Details:      
 
Weak hits

Sequence:  gi|24308458|ref|NP_714924.1|
Domain Number - Region: 43-55
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000392
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|24308458|ref|NP_714924.1|
Sequence length 337
Comment LIX1-like protein [Homo sapiens]
Sequence
METMRAQRLQPGVGTSGRGTLRALRPGVTGAAAATATPPAGPPPAPPPPAPPPPPLLLSG
APGLPLPPGAAGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKN
GALVVYEMVPSNSPPYVCYVTLPGGSCFGSFQFCPTKAEARRSAAKIALMNSVFNEHPSR
RITDEFIEKSVSEALASFNGNREEADNPNTGIGAFRFMLESNKGKSMLEFQELMTVFQLL
HWNGSLKAMRERQCSRQEVLAHYSHRALDDDIRHQMALDWVSREQSVPGALSRELASTER
ELDEARLAGKELRFHKEKKDILVLAAGQLGNMHSSNC
Download sequence
Identical sequences G3RMP0 H2N622 H2PZT7 Q8IVB5
ENSP00000358314 HR5188 9598.ENSPTRP00000002047 9600.ENSPPYP00000001081 9606.ENSP00000358314 ENSPPYP00000001081 ENSGGOP00000005293 ENSPPYP00000001081 gi|24308458|ref|NP_714924.1| ENSPTRP00000002047 ENSGGOP00000017055 ENSP00000474487 NP_714924.1.87134 NP_714924.1.92137 XP_001162231.1.37143 XP_002810360.1.23681 XP_003806238.1.60992 XP_004026533.1.27298 ENSP00000358314 ENSPTRP00000002047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]