SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|24586688|ref|NP_543139.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24586688|ref|NP_543139.4|
Domain Number 1 Region: 61-326
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.45e-48
Family Ankyrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 404-446
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000523
Family SOCS box-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|24586688|ref|NP_543139.4|
Sequence length 453
Comment ankyrin repeat and SOCS box protein 16 [Homo sapiens]
Sequence
MARETFPFTSSMLRSLRLQQEWLEWEDRRRAAAQQCRSRRCPSSPRARLTRPHRSCRDPA
VHQALFSGNLQQVQALFQDEEAANMIVETVSNQLAWSAEQGFWVLTPKTKQTAPLAIATA
RGYTDCARHLIRQGAELDARVGGRAALHEACARAQFDCVRLLLTFGAKANVLTEEGTTPL
HLCTIPESLQCAKLLLEAGATVNLAAGESQETPLHVAAARGLEQHVALYLEHGADVGLRT
SQGETALNTACAGAEGPGSCRRHQAAARRLLEAGADARAAGRKRHTPLHNACANGCGGLA
ELLLRYGARAEVPNGAGHTPMDCALQAVQDSPNWEPEVLFAALLDYGAQPVRPEMLKHCA
NFPRALEVLLNAYPCVPSCETWVEAVLPELWKEHEAFYSSALCMVNQPRQLQHLARLAVR
ARLGSRCRQGATRLPLPPLLRDYLLLRVEGCIQ
Download sequence
Identical sequences Q96NS5
9606.ENSP00000293414 ENSP00000293414 NP_543139.4.87134 NP_543139.4.92137 ENSP00000293414 gi|24586688|ref|NP_543139.4| ENSP00000293414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]