SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|25121993|ref|NP_733839.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|25121993|ref|NP_733839.1|
Domain Number 1 Region: 106-240
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.26e-27
Family Canonical RBD 0.0000198
Further Details:      
 
Domain Number 2 Region: 15-101
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.01e-25
Family Canonical RBD 0.0000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|25121993|ref|NP_733839.1|
Sequence length 251
Comment RNA-binding protein Musashi homolog 2 isoform b [Homo sapiens]
Sequence
MADLTSVLTSVMFSPSSKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGF
GFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVE
DVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKK
AQPKEVMFPPGTRGRARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPDY
LPVSQDIIFIN
Download sequence
Identical sequences A0A2I2ZRZ6 A0A2I3RJA8
gi|25121993|ref|NP_733839.1| ENSP00000313616 NP_733839.1.87134 NP_733839.1.92137 XP_004041349.1.27298 XP_008968849.1.60992 ENSP00000313616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]