SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|25168263|ref|NP_005618.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|25168263|ref|NP_005618.2|
Domain Number 1 Region: 74-401
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-94
Family Protein kinases, catalytic subunit 0.0000000505
Further Details:      
 
Weak hits

Sequence:  gi|25168263|ref|NP_005618.2|
Domain Number - Region: 26-62
Classification Level Classification E-value
Superfamily PX domain 0.00523
Family PX domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|25168263|ref|NP_005618.2|
Sequence length 431
Comment serine/threonine-protein kinase Sgk1 isoform 1 [Homo sapiens]
Sequence
MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKI
SQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE
EVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYIN
GGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTD
FGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSR
NTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINW
DDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLG
FSYAPPTDSFL
Download sequence
Identical sequences A0A2I3H0Z4 A0A2J8X996 G3S3Y0 O00141
ENSP00000237305 ENSGGOP00000022781 gi|25168263|ref|NP_005618.2| ENSP00000237305 NP_005618.2.87134 NP_005618.2.92137 XP_003255792.1.23891 XP_004044758.1.27298 XP_008951271.1.60992 XP_009240546.1.23681 HR6376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]