SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|253314443|ref|NP_001156592.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253314443|ref|NP_001156592.1|
Domain Number 1 Region: 63-144
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000000000207
Family The homologous-pairing domain of Rad52 recombinase 0.015
Further Details:      
 
Domain Number 2 Region: 11-86
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000133
Family Canonical RBD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|253314443|ref|NP_001156592.1|
Sequence length 166
Comment RAD52 motif-containing protein 1 isoform 3 [Homo sapiens]
Sequence
MAELVPFAVPIESDKTLLVWELSSGPTAEALHHSLFTAFSQFGLLYSVRVFPNAAVAHPG
FYAVIKFYSARAAHRAQKACDRKQLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANY
YFGFNGCSKRIIKVPCSPWKQYGQEEEGYLSDFSLEEEEFRLPELD
Download sequence
Identical sequences NP_001156592.1.87134 NP_001156592.1.92137 gi|253314443|ref|NP_001156592.1| ENSP00000478597 ENSP00000483387 ENSP00000393620 ENSP00000475050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]