SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|253314451|ref|NP_001156596.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253314451|ref|NP_001156596.1|
Domain Number 1 Region: 40-121
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000000000138
Family The homologous-pairing domain of Rad52 recombinase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|253314451|ref|NP_001156596.1|
Sequence length 143
Comment RAD52 motif-containing protein 1 isoform 6 [Homo sapiens]
Sequence
MHLLVPPPQHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHRAQKACDRK
QLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANYYFGFNGCSKRIIKVPCSPWKQYG
QEEEGYLSDFSLEEEEFRLPELD
Download sequence
Identical sequences gi|253314451|ref|NP_001156596.1| NP_001156596.1.87134 NP_001156596.1.92137 ENSP00000465749 ENSP00000473860 ENSP00000479622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]