SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|253314453|ref|NP_001156597.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253314453|ref|NP_001156597.1|
Domain Number 1 Region: 40-112
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000000000628
Family The homologous-pairing domain of Rad52 recombinase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|253314453|ref|NP_001156597.1|
Sequence length 116
Comment RAD52 motif-containing protein 1 isoform 7 [Homo sapiens]
Sequence
MHLLVPPPQHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHRAQKACDRK
QLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANYYFGFNGCSKRIIKDHYHSL
Download sequence
Identical sequences ENSP00000480131 ENSP00000481648 ENSP00000481726 gi|253314453|ref|NP_001156597.1| ENSP00000378035 ENSP00000466065 ENSP00000474173 ENSP00000474351 NP_001156597.1.87134 NP_001156597.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]