SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|253314472|ref|NP_001156602.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253314472|ref|NP_001156602.1|
Domain Number 1 Region: 40-242
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.02e-35
Family The homologous-pairing domain of Rad52 recombinase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|253314472|ref|NP_001156602.1|
Sequence length 261
Comment RAD52 motif-containing protein 1 isoform 8 [Homo sapiens]
Sequence
MHLLVPPPQHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHRAQKACDRK
QLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANYYFGFNGCSKRIIKLQELSDLEER
ENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLVEEPMDKVEEGPLSFLMKRKTAQK
LAIQKALSDAFQKLLIVVLESGKIAVEYRPSEDIVGVRCEEELHGLIQVPCSPWKQYGQE
EEGYLSDFSLEEEEFRLPELD
Download sequence
Identical sequences ENSP00000378037 ENSP00000474374 NP_001156602.1.87134 NP_001156602.1.92137 ENSP00000479310 gi|253314472|ref|NP_001156602.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]