SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|255982572|ref|NP_001157637.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255982572|ref|NP_001157637.1|
Domain Number 1 Region: 52-306
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.54e-68
Family Ankyrin repeat 0.0000638
Further Details:      
 
Domain Number 2 Region: 252-408
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.97e-16
Family Ankyrin repeat 0.0048
Further Details:      
 
Domain Number 3 Region: 490-540
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000746
Family SOCS box-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|255982572|ref|NP_001157637.1|
Sequence length 556
Comment GPR75-ASB3 protein [Homo sapiens]
Sequence
MAMMPLVLHHPERQAELGSGLRDGGGAALRPPGRLVKQMDFTEAYADTCSTVGLAAREGN
VKVLRKLLKKGRSVDVADNRGWMPIHEAAYHNSVECLQMLINADSSENYIKMKTFEGFCA
LHLAASQGHWKIVQILLEAGADPNATTLEETTPLFLAVENGQIDVLRLLLQHGANVNGSH
SMCGWNSLHQASFQENAEIIKLLLRKGANKECQDDFGITPLFVAAQYGKLESLSILISSG
ANVNCQALDKATPLFIAAQEGHTKCVELLLSSGADPDLYCNEDSWQLPIHAAAQMGHTKI
LDLLIPLTNRACDTGLNKVSPVYSAVFGGHEDCLEILLRNGYSPDAQACLVFGFSSPVCM
AFQKDCEFFGIVNILLKYGAQINELHLAYCLKYEKFSIFRYFLRKGCSLGPWNHIYEFVN
HAIKAQAKYKEWLPHLLVAGFDPLILLCNSWIDSVSIDTLIFTLEFTNWKTLAPAVERML
SARASNAWILQQHIATVPSLTHLCRLEIRSSLKSERLRSDSYISQLPLPRSLHNYLLYED
VLRMYEVPELAAIQDG
Download sequence
Identical sequences A0A0A6YYF3
gi|255982572|ref|NP_001157637.1| ENSP00000385085 ENSP00000313756 NP_001157637.1.87134 NP_001157637.1.92137 ENSP00000313756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]