SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256418995|ref|NP_001157852.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256418995|ref|NP_001157852.1|
Domain Number 1 Region: 303-379
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.29e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.0000299
Further Details:      
 
Domain Number 2 Region: 205-284
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.43e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.00031
Further Details:      
 
Domain Number 3 Region: 3-85
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.73e-17
Family Double-stranded RNA-binding domain (dsRBD) 0.0039
Further Details:      
 
Domain Number 4 Region: 85-200
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000000000251
Family Double-stranded RNA-binding domain (dsRBD) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256418995|ref|NP_001157852.1|
Sequence length 570
Comment double-stranded RNA-binding protein Staufen homolog 2 isoform a [Homo sapiens]
Sequence
MANPKEKTAMCLVNELARFNRVQPQYKLLNERGPAHSKMFSVQLSLGEQTWESEGSSIKK
AQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKP
FPNYRANYNFRGMYNQRYHCPVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQALQ
NEPIPERSPQNGESGKDVDDDKDANKSEISLVFEIALKRNMPVSFEVIKESGPPHMKSFV
TRVSVGEFSAEGEGNSKKLSKKRAATTVLQELKKLPPLPVVEKPKLFFKKRPKTIVKAGP
EYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEVATGTGPNKKI
AKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVY
QEMEASRHKVISGTTLGYLSPKDMNQPSSSFFSISPTSNSSATIARELLMNGTSSTAEAI
GLKGSSPTPPCSPVQPSKQLEYLARIQGFQAALSALKQFSEQGLDPIDGAMNIEKGSLEK
QAKHLREKADNNQAPPGSIAQDCKKSNSAV
Download sequence
Identical sequences Q9NUL3
gi|256418995|ref|NP_001157852.1| ENSP00000428756 ENSP00000348026 ENSP00000428756 NP_001157852.1.87134 NP_001157852.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]