SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256419005|ref|NP_001157857.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256419005|ref|NP_001157857.1|
Domain Number 1 Region: 265-341
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 4.71e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.0000299
Further Details:      
 
Domain Number 2 Region: 167-246
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.07e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.00031
Further Details:      
 
Domain Number 3 Region: 47-161
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000000000189
Family Double-stranded RNA-binding domain (dsRBD) 0.01
Further Details:      
 
Domain Number 4 Region: 1-47
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000147
Family Double-stranded RNA-binding domain (dsRBD) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256419005|ref|NP_001157857.1|
Sequence length 473
Comment double-stranded RNA-binding protein Staufen homolog 2 isoform f [Homo sapiens]
Sequence
MFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTV
ELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHCPVPKIFYVQLTVGNNEFF
GEGKTRQAARHNAAMKALQALQNEPIPERSPQNGESGKDVDDDKDANKSEISLVFEIALK
RNMPVSFEVIKESGPPHMKSFVTRVSVGEFSAEGEGNSKKLSKKRAATTVLQELKKLPPL
PVVEKPKLFFKKRPKTIVKAGPEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRR
EFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPK
PGFPEPTNNTPKGILHLSPDVYQEMEASRHKVISGTTLGYLSPKDMNQPSSSFFSISPTS
NSSATIARELLMNGTSSTAEAIGLKGSSPTPPCSPVQPSKQLEYLARIQGFQV
Download sequence
Identical sequences A0A0A0MTD1
NP_001157857.1.87134 NP_001157857.1.92137 ENSP00000431111 gi|256419005|ref|NP_001157857.1| ENSP00000431111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]