SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256574784|ref|NP_001157912.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256574784|ref|NP_001157912.1|
Domain Number 1 Region: 86-243
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.14e-31
Family Ankyrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256574784|ref|NP_001157912.1|
Sequence length 494
Comment ankyrin repeat domain-containing protein 33B [Homo sapiens]
Sequence
MVLLAGTGPEGGGARCMTPPPPSPPRGAQVEEDPADYEEFEDFSSLPDTRSIASDDSFYP
FEDEEEHGVESAESVPEGVPESVPETATLLRAACANNVGLLRTLVRRGVSVEEAQETDRN
GRTGLIVACYHGFVDTVVALAECPHVDVNWQDSEGNTALITAAQAGHAIITNYLLNYFPG
LDLERRNAFGFTALMKAAMQGRTDCIRALMLAGADVHARDPRRGMSPQEWATYTGRVDAV
RLMQRLLERPCPEQFWEKYRPELPPPPEAARKPAGSKNCLQRLTDCVLSVLTPRSVRGPE
DGGVLDHMVRMTTSLYSPAVAIVCQTVCPESPPSVGKRRLAVQEILAARAARGPQAQEED
EVGGAGQRGRTGQEDADSREGSPRAGLPPALGSRGPAAPAPRKASLLPLQRLRRRSVRPG
VVVPRVRVSKAPAPTFQPERPARKGSTKDSGHLQIPKWRYKEAKEEKRKAEEAEKKRQAE
AQKERRTAPWKKRT
Download sequence
Identical sequences A6NCL7
NP_001157912.1.87134 NP_001157912.1.92137 9606.ENSP00000296657 gi|256574784|ref|NP_001157912.1| ENSP00000296657 ENSP00000296657 ENSP00000422195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]