SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256985102|ref|NP_001157941.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256985102|ref|NP_001157941.1|
Domain Number 1 Region: 45-133
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 6.28e-23
Family Supernatant protein factor (SPF), C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256985102|ref|NP_001157941.1|
Sequence length 188
Comment TRAM adaptor with GOLD domain isoform 2 [Homo sapiens]
Sequence
MPRPGSAQRWAAVAGRWGCRLLALLLLVPGPGGASEITFELPDNAKQCFYEDIAQGTKCT
LEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHK
TVYFDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAE
DLNTRVAY
Download sequence
Identical sequences A0A0A6YYA0
ENSP00000333650 ENSP00000333650 NP_001157941.1.87134 NP_001157941.1.92137 gi|256985102|ref|NP_001157941.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]