SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257467559|ref|NP_001004441.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257467559|ref|NP_001004441.2|
Domain Number 1 Region: 9-140
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.08e-27
Family Ankyrin repeat 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257467559|ref|NP_001004441.2|
Sequence length 514
Comment ankyrin repeat domain-containing protein 34B [Homo sapiens]
Sequence
MDEGMEISSEGNSLIKAVHQSRLRLTRLLLEGGAYINESNDRGETPLMIACKTKHVDHQS
VSKAKMVKYLLENNADPNIQDKSGKTALMHACLEKAGPEVVSLLLKSGADLSLQDHSSYS
ALVYAINSEDTETLKVLLSACKAKGKEVIIITTAKLPCGKHTTKQYLNMPPVDIDGCHSP
ATCTTPSEIDIKTASSPLSHSSETELTLFGFKDLELAGSNDDTWDPGSPVRKPALAPKGP
KLPHAPPWVKSPPLLMHQNRVASLQEELQDITPEEELSYKTNGLALSKRFITRHQSIDVK
DTAHLLRAFDQASSRKMSYDEINCQSYLSEGNQQCIEVPVDQDPDSNQTIFASTLRSIVQ
KRNLGANHYSSDSQLSAGLTPPTSEDGKALIGKKKILSPSPSQLSESKELLENIPPGPLS
RRNHAVLERRGSGAFPLDHSVTQTRQGFLPPLNVNSHPPISDINVNNKICSLLSCGQKVL
MPTVPIFPKEFKSKKMLLRRQSLQTEQIKQLVNF
Download sequence
Identical sequences A5PLL1
ENSP00000339802 ENSP00000339802 9606.ENSP00000339802 NP_001004441.2.87134 NP_001004441.2.92137 XP_006714662.1.92137 XP_011541668.1.92137 XP_011541671.1.92137 gi|257467559|ref|NP_001004441.2| ENSP00000339802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]