SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|25777624|ref|NP_742024.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|25777624|ref|NP_742024.1|
Domain Number 1 Region: 103-201
Classification Level Classification E-value
Superfamily POZ domain 3.49e-24
Family BTB/POZ domain 0.003
Further Details:      
 
Domain Number 2 Region: 271-374
Classification Level Classification E-value
Superfamily POZ domain 1.13e-23
Family BTB/POZ domain 0.021
Further Details:      
 
Domain Number 3 Region: 5-78
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000466
Family Ankyrin repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|25777624|ref|NP_742024.1|
Sequence length 478
Comment ankyrin repeat and BTB/POZ domain-containing protein 1 isoform 2 [Homo sapiens]
Sequence
MDTSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPLYYACLCGHEELVLYLLANGA
RCEANTFDGERCLYGALSDPIRRALRDYKQVTASCRRRDYYDDFLQRLLEQGIHSDVVFV
VHGKPFRVHRCVLGARSAYFANMLDTKWKGKSVVVLRHPLINPVAFGALLQYLYTGRLDI
GVEHVSDCERLAKQCQLWDLLSDLEAKCEKVSEFVASKPGTCVKVLTIEPPPADPRLRED
MALLADCALPPELRGDLWELPFPCPDGFNSCPDICFRVAGCSFLCHKAFFCGRSDYFRAL
LDDHFRESEEPATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAYDVLSVADMYL
LPGLKRLCGRSLAQMLDEDTVVGVWRVAKLFRLARLEDQCTEYMAKVIEKLVEREDFVEA
VKEEAAAVAARQETDSIPLVDDIRFHVASTVQTYSAIEEAQQRLRALEDLLVSIGLDC
Download sequence
Identical sequences Q969K4
HR6093 9606.ENSP00000232744 ENSP00000232744 ENSP00000377030 gi|25777624|ref|NP_742024.1| NP_742024.1.87134 NP_742024.1.92137 ENSP00000232744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]