SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|259155302|ref|NP_001158884.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|259155302|ref|NP_001158884.1|
Domain Number 1 Region: 41-252
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.53e-83
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000171
Further Details:      
 
Domain Number 2 Region: 542-760
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.62e-59
Family Ankyrin repeat 0.0000188
Further Details:      
 
Domain Number 3 Region: 248-380
Classification Level Classification E-value
Superfamily E set domains 3.27e-47
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000113
Further Details:      
 
Domain Number 4 Region: 808-889
Classification Level Classification E-value
Superfamily DEATH domain 7.06e-16
Family DEATH domain, DD 0.0044
Further Details:      
 
Weak hits

Sequence:  gi|259155302|ref|NP_001158884.1|
Domain Number - Region: 874-922
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.0102
Family DNA polymerase beta, N-terminal domain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|259155302|ref|NP_001158884.1|
Sequence length 968
Comment nuclear factor NF-kappa-B p105 subunit isoform 2 [Homo sapiens]
Sequence
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE
VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT
SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ
EGPLEGKI
Download sequence
Identical sequences A0A024RDJ4 K7DQM6 P19838
gi|259155302|ref|NP_001158884.1| ENSP00000378297 ENSP00000424790 ENSP00000378297 ENSP00000424790 HR3633 NP_001158884.1.87134 NP_001158884.1.92137 NP_001306155.1.87134 NP_001306155.1.92137 XP_009446347.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]