SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|259906403|ref|NP_001159367.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|259906403|ref|NP_001159367.1|
Domain Number 1 Region: 83-125
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000089
Family LDL receptor-like module 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|259906403|ref|NP_001159367.1|
Sequence length 240
Comment CD320 antigen isoform 2 precursor [Homo sapiens]
Sequence
MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGIEPCTQKGQCPP
PPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSS
DELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQ
SGSPTAYGVIAAAAVLSASLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP
Download sequence
Identical sequences ENSP00000437697 NP_001159367.1.87134 NP_001159367.1.92137 gi|259906403|ref|NP_001159367.1| ENSP00000437697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]