SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|260763963|ref|NP_001120979.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260763963|ref|NP_001120979.2|
Domain Number 1 Region: 212-267
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000497
Family Ankyrin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260763963|ref|NP_001120979.2|
Sequence length 652
Comment B-cell scaffold protein with ankyrin repeats isoform 3 [Homo sapiens]
Sequence
MLPAAPGKGLGSPDPAPCGPAPPDSEDYFEVNIPTDLRAKHSGEISERKEIEELSEASRN
TIPLAVVLPTEIPCENPGEIFIILRDEVIGDTVEVEFTSSNKRIRTRPALWNKKVWCMKA
LEFPAGSVHVNVYCDGIVKATTKIKYYPTAKAKECLFRMADSGESLCQNSIEELDGVLTS
IFKHEIPYYEFQSLQTEICSQNKYTHFKELPTLLHCAAKFGLKNLAIHLLQCSGATWASK
MKNMEGSDPAHIAERHGHKELKKIFEDFSIQEIDINNEQENDYEEDIASFSTYIPSTQNP
AFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPLEVGSESSEDQYDDLYVFIPG
ADPENNSQEPLMSSRPPLPPPRPVANAFQLERPHFTLPGTMVEGQMERSQNWGHPGVRQE
TGDEPKGEKEKKEEEKEQEEEEDPYTFAEIDDSEYDMILANLSIKKKTGSRSFIINRPPA
PTPRPTSIPPKEETTPYIAQVFQQKTARRQSDDDKFRGLPKKQDRARIESPAFSTLRGCL
TDGQEELILLQEKVKNGKMSMDEALEKFKHWQMGKSGLEMIQQEKLRQLRDCIIGKRPEE
ENVYNKLTIVHHPGGKETAHNENKFYNVHFSNKLPARPQVEKEFGFCCKKDH
Download sequence
Identical sequences NP_001120979.2.87134 NP_001120979.2.92137 gi|260763963|ref|NP_001120979.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]