SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261337167|ref|NP_000618.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261337167|ref|NP_000618.3|
Domain Number 1 Region: 1018-1084
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.09e-20
Family TB module/8-cys domain 0.00000796
Further Details:      
 
Domain Number 2 Region: 346-413
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.58e-20
Family TB module/8-cys domain 0.00041
Further Details:      
 
Domain Number 3 Region: 1192-1253
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.14e-17
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 4 Region: 794-925
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000133
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 226-296
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000222
Family TB module/8-cys domain 0.0037
Further Details:      
 
Domain Number 6 Region: 679-798
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000424
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 587-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000218
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 8 Region: 918-971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000336
Family EGF-type module 0.018
Further Details:      
 
Domain Number 9 Region: 546-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000456
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 10 Region: 292-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000097
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 11 Region: 1295-1381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000847
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 12 Region: 1136-1181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000807
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 13 Region: 624-667
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000865
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 14 Region: 1096-1145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000243
Family EGF-type module 0.015
Further Details:      
 
Domain Number 15 Region: 77-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000653
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  gi|261337167|ref|NP_000618.3|
Domain Number - Region: 963-989
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0107
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|261337167|ref|NP_000618.3|
Sequence length 1395
Comment latent-transforming growth factor beta-binding protein 1 isoform LTBP-1S precursor [Homo sapiens]
Sequence
MDTKLMCLLFFFSLPPLLVSNHTGRIKVVFTPSICKVTCTKGSCQNSCEKGNTTTLISEN
GHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCPPNFTGKLCQIPVHGASVPKLYQHS
QQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDGP
TGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSHQQVIPHVYPVAAKTQLGRCFQETIGS
QCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKKPSYHGYNQMMECLPGYKRVNNTFCQD
INECQLQGVCPNGECLNTMGSYRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLVSSG
RQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAAFKEICPGGMGYTVSGVHRRRPI
HHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAEPEVATAPPEK
EIPSLDQEKTKLEPGQPQLSPGISTIHLHPQFPVVIEKTSPPVPVEVAPEASTSSASQVI
APTQVTEINECTVNPDICGAGHCINLPVRYTCICYEGYRFSEQQRKCVDIDECTQVQHLC
SQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDS
GYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPN
VCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCKNTEGSFRCTCG
QGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEGSFQCVCDQGYRASGLGDHCEDINECL
EDKSVCQRGDCINTAGSYDCTCPDGFQLDDNKTCQDINECEHPGLCGPQGECLNTEGSFH
CVCQQGFSISADGRTCEDIDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVD
VNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRTSTDLDVDVDQPKEEK
KECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVLGTAEFTEMCPKGKG
FVPAGESSSEAGGENYKDADECLLFGQEICKNGFCLNTRPGYECYCKQGTYYDPVKLQCF
DMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPAESNEQIEETDVYQDLC
WEHLSDEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPLKDSDDYAQLCNIPVTGRRQ
PYGRDALVDFSEQYTPEADPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCD
CFDGYHLDTAKMTCVDVNECDELNNRMSLCKNAKCINTDGSYKCLCLPGYVPSDKPNYCT
PLNTALNLEKDSDLE
Download sequence
Identical sequences NP_000618.3.87134 NP_000618.3.92137 gi|261337167|ref|NP_000618.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]