SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261337171|ref|NP_001159737.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261337171|ref|NP_001159737.1|
Domain Number 1 Region: 965-1031
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.03e-20
Family TB module/8-cys domain 0.00000796
Further Details:      
 
Domain Number 2 Region: 1139-1200
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.01e-17
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 3 Region: 349-396,492-512
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-16
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 4 Region: 744-872
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000188
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 626-745
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000118
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 226-296
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000209
Family TB module/8-cys domain 0.0037
Further Details:      
 
Domain Number 7 Region: 534-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000218
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 8 Region: 865-918
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000503
Family EGF-type module 0.018
Further Details:      
 
Domain Number 9 Region: 292-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000839
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 10 Region: 1242-1328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 1083-1128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000774
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 12 Region: 571-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000812
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 13 Region: 1043-1092
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000207
Family EGF-type module 0.015
Further Details:      
 
Domain Number 14 Region: 77-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000062
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  gi|261337171|ref|NP_001159737.1|
Domain Number - Region: 910-936
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00943
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|261337171|ref|NP_001159737.1|
Sequence length 1342
Comment latent-transforming growth factor beta-binding protein 1 isoform 3 precursor [Homo sapiens]
Sequence
MDTKLMCLLFFFSLPPLLVSNHTGRIKVVFTPSICKVTCTKGSCQNSCEKGNTTTLISEN
GHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCPPNFTGKLCQIPVHGASVPKLYQHS
QQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDGP
TGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSHQQVIPHVYPVAAKTQLGRCFQETIGS
QCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKKPSYHGYNQMMECLPGYKRVNNTFCQD
INECQLQGVCPNGECLNTMGSYRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLVSSG
RQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAKEEPVEALTFSREHGPGVAEPEV
ATAPPEKEIPSLDQEKTKLEPGQPQLSPGISTIHLHPQFPVVIEKTSPPVPVEVAPEAST
SSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCICYEGYRFSEQQRKCVDIDEC
TQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAF
RCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDV
DECLEPNVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCKNTEG
SFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEGSFQCVCDQGYRASGLGDHC
EDINECLEDKSVCQRGDCINTAGSYDCTCPDGFQLDDNKTCQDINECEHPGLCGPQGECL
NTEGSFHCVCQQGFSISADGRTCEDIDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQ
DGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRTSTDLDVDV
DQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVLGTAEFTE
MCPKGKGFVPAGESSSEAGGENYKDADECLLFGQEICKNGFCLNTRPGYECYCKQGTYYD
PVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPAESNEQIEET
DVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPLKDSDDYAQLCNI
PVTGRRQPYGRDALVDFSEQYTPEADPYFIQDRFLNSFEELQAEECGILNGCENGRCVRV
QEGYTCDCFDGYHLDTAKMTCVDVNECDELNNRMSLCKNAKCINTDGSYKCLCLPGYVPS
DKPNYCTPLNTALNLEKDSDLE
Download sequence
Identical sequences gi|261337171|ref|NP_001159737.1| NP_001159737.1.87134 NP_001159737.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]