SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|268607512|ref|NP_001161329.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|268607512|ref|NP_001161329.1|
Domain Number 1 Region: 61-291
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.6e-59
Family Ankyrin repeat 0.0000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|268607512|ref|NP_001161329.1|
Sequence length 515
Comment protein phosphatase 1 regulatory subunit 12B isoform e [Homo sapiens]
Sequence
MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGA
VFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQ
DNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQ
GVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAG
YELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEL
LQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSS
SSEEEEGEDEASESETEKEADKKPEAFVNHSNSESKSSITEQIPAPAQNTFSASSARRFS
SGLFNKPEEPKDESPSSWRLGLRKTGSHNMLSEVANSREPIRDRGSSIYRSSSSPRISAL
LDNKDKVQFGRVWGNSKAVFFFHENSILGTNENIF
Download sequence
Identical sequences A0A2J8QWK8
NP_001161329.1.87134 NP_001161329.1.92137 ENSP00000417159 gi|268607512|ref|NP_001161329.1| ENSP00000417159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]