SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|268834192|ref|NP_000172.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|268834192|ref|NP_000172.2|
Domain Number 1 Region: 329-629
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.88e-92
Family beta-glycanases 0.0000000000157
Further Details:      
 
Domain Number 2 Region: 24-224
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.58e-58
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00000000202
Further Details:      
 
Domain Number 3 Region: 226-328
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 2.59e-29
Family beta-Galactosidase/glucuronidase domain 0.00000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|268834192|ref|NP_000172.2|
Sequence length 651
Comment beta-glucuronidase precursor [Homo sapiens]
Sequence
MARGSAVAWAALGPLLWGCALGLQGGMLYPQESPSRECKELDGLWSFRADFSDNRRRGFE
EQWYRRPLWESGPTVDMPVPSSFNDISQDWRLRHFVGWVWYEREVILPERWTQDLRTRVV
LRIGSAHSYAIVWVNGVDTLEHEGGYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTT
LPPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTSVEQD
SGLVNYQISVKGSNLFKLEVRLLDAENKVVANGTGTQGQLKVPGVSLWWPYLMHERPAYL
YSLEVQLTAQTSLGPVSDFYTLPVGIRTVAVTKSQFLINGKPFYFHGVNKHEDADIRGKG
FDWPLLVKDFNLLRWLGANAFRTSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNN
VSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMVIAHTKSLDPSRPVT
FVSNSNYAADKGAPYVDVICLNSYYSWYHDYGHLELIQLQLATQFENWYKKYQKPIIQSE
YGAETIAGFHQDPPLMFTEEYQKSLLEQYHLGLDQKRRKYVVGELIWNFADFMTEQSPTR
VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSLFT
Download sequence
Identical sequences P08236
ENSP00000302728 ENSP00000302728 NP_000172.2.87134 NP_000172.2.92137 ENSP00000302728 9606.ENSP00000302728 gi|268834192|ref|NP_000172.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]