SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|268840316|ref|NP_001161401.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|268840316|ref|NP_001161401.1|
Domain Number 1 Region: 394-550
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.66e-29
Family Toll/Interleukin receptor TIR domain 0.00051
Further Details:      
 
Domain Number 2 Region: 32-139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000153
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 242-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000232
Family I set domains 0.037
Further Details:      
 
Domain Number 4 Region: 154-268
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000477
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|268840316|ref|NP_001161401.1|
Sequence length 570
Comment interleukin-1 receptor accessory protein isoform 1 [Homo sapiens]
Sequence
MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYST
AHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTT
YCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMG
CYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNA
VPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINE
SISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVEL
ACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF
VLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQAL
LELKAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWK
QLQVAMPVKKSPRRSSSDEQGLSYSSLKNV
Download sequence
Identical sequences A0A2J8WI11 H2QNY9 Q9NPH3
HR6008 NYSGRC-IgSF-IL1AP_HUMAN 9598.ENSPTRP00000027076 9606.ENSP00000072516 ENSP00000072516 ENSP00000390541 ENSP00000401132 ENSP00000412053 ENSPTRP00000027076 ENSP00000072516 ENSP00000390541 ENSP00000401132 ENSP00000412053 gi|268840214|ref|NP_001161400.1| gi|268840316|ref|NP_001161401.1| gi|4504661|ref|NP_002173.1| NP_001161400.1.87134 NP_001161400.1.92137 NP_001161401.1.87134 NP_001161401.1.92137 NP_002173.1.87134 NP_002173.1.92137 XP_003825018.1.60992 XP_016797990.1.37143 XP_016797991.1.37143 ENSPTRP00000027076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]