SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|268840382|ref|NP_001161403.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|268840382|ref|NP_001161403.1|
Domain Number 1 Region: 395-546
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.7e-27
Family Toll/Interleukin receptor TIR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 32-139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000201
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 242-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000309
Family I set domains 0.037
Further Details:      
 
Domain Number 4 Region: 155-268
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000699
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|268840382|ref|NP_001161403.1|
Sequence length 687
Comment interleukin-1 receptor accessory protein isoform 3 [Homo sapiens]
Sequence
MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYST
AHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTT
YCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMG
CYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNA
VPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINE
SISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVEL
ACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF
VLLTLRGVLENEFGYKLCIFDRDSLPGGNTVEAVFDFIQRSRRMIVVLSPDYVTEKSISM
LEFKLGVMCQNSIATKLIVVEYRPLEHPHPGILQLKESVSFVSWKGEKSKHSGSKFWKAL
RLALPLRSLSASSGWNESCSSQSDISLDHVQRRRSRLKEPPELQSSERAAGSPPAPGTMS
KHRGKSSATCRCCVTYCEGENHLRNKSRAEIHNQPQWETHLCKPVPQESETQWIQNGTRL
EPPAPQISALALHHFTDLSNNNDFYIL
Download sequence
Identical sequences A0A2I3T322
gi|268840382|ref|NP_001161403.1| ENSP00000314807 ENSP00000408893 ENSP00000314807 ENSP00000408893 ENSP00000389149 NP_001161403.1.87134 NP_001161403.1.92137 XP_008976909.1.60992 XP_016797985.1.37143 XP_016797986.1.37143 XP_016797987.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]