SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|271398185|ref|NP_001162002.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271398185|ref|NP_001162002.1|
Domain Number 1 Region: 29-228
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.9e-45
Family Ankyrin repeat 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|271398185|ref|NP_001162002.1|
Sequence length 252
Comment ankyrin repeat and SOCS box protein 9 isoform 3 [Homo sapiens]
Sequence
MDGKQGGMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGW
AVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACVSGSWDCVNL
LLQHGASVQPESDLASPIHEAARRAYGGNIDHKISHLGTPLYLACENQQRACVKKLLESG
ADVNQGKGQDSPLHAVARTASEELACLLMDFGADTQAKNAEGKRPVELVPPESPLAQLFL
EREGASLPKPKP
Download sequence
Identical sequences A0A024RBZ4
ENSP00000369850 NP_001162002.1.87134 NP_001162002.1.92137 GO.37818 ENSP00000369850 gi|271398185|ref|NP_001162002.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]