SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|271398201|ref|NP_001162003.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271398201|ref|NP_001162003.1|
Domain Number 1 Region: 29-238
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.93e-52
Family Ankyrin repeat 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|271398201|ref|NP_001162003.1|
Sequence length 262
Comment ankyrin repeat and SOCS box protein 9 isoform 2 [Homo sapiens]
Sequence
MDGKQGGMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGW
AVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACVSGSWDCVNL
LLQHGASVQPESDLASPIHEAARRGHVECVNSLIAYGGNIDHKISHLGTPLYLACENQQR
ACVKKLLESGADVNQGKGQDSPLHAVARTASEELACLLMDFGADTQAKNAEGKRPVELVP
PESPLAQLFLEREGASLPKPKP
Download sequence
Identical sequences A0A024RBW2
ENSP00000369852 ENSP00000438943 gi|13443014|ref|NP_076992.1| gi|271398201|ref|NP_001162003.1| ENSP00000369852 ENSP00000438943 NP_001162003.1.87134 NP_001162003.1.92137 NP_076992.1.87134 NP_076992.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]