SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27477049|ref|NP_543144.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27477049|ref|NP_543144.1|
Domain Number 1 Region: 250-292
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000144
Family SOCS box-like 0.0042
Further Details:      
 
Domain Number 2 Region: 92-171
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000533
Family Ankyrin repeat 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|27477049|ref|NP_543144.1|
Sequence length 295
Comment ankyrin repeat and SOCS box protein 17 [Homo sapiens]
Sequence
MSKSTKLCGKTSCPRSNIFCNLLDKIVKRPSLQFLGQWGYHCYEPRIYRSLAKILRYVDL
DGFDALLTDYIAFVEKSGYRFEVSFNLDFTEICVNTILYWVFARKGNPDFVELLLKKTKD
YVQDRSCNLALIWRTFTPVYCPSPLSGITPLFYVAQTRQSNIFKILLQYGILEREKNPIN
IVLTIVLYPSRVRVMVDRELADIHEDAKTCLVLCSRVLSVISVKEIKTQLSLGRHPIISN
WFDYIPSTRYKDPCELLHLCRLTIRNQLLTNNMLPDGIFSLLIPARLQNYLNLEI
Download sequence
Identical sequences Q8WXJ9
9606.ENSP00000284142 ENSP00000284142 NP_543144.1.87134 NP_543144.1.92137 gi|27477049|ref|NP_543144.1| ENSP00000284142 ENSP00000284142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]