SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27544931|ref|NP_666019.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27544931|ref|NP_666019.1|
Domain Number 1 Region: 39-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.58e-39
Family SCAN domain 0.0000412
Further Details:      
 
Domain Number 2 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 275-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 313-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-18
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 5 Region: 414-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.78e-18
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|27544931|ref|NP_666019.1|
Sequence length 473
Comment zinc finger and SCAN domain-containing protein 21 [Homo sapiens]
Sequence
MMTKVLGMAPVLGPRPPQEQVGPLMVKVEEKEEKGKYLPSLEMFRQRFRQFGYHDTPGPR
EALSQLRVLCCEWLRPEIHTKEQILELLVLEQFLTILPQELQAWVQEHCPESAEEAVTLL
EDLERELDEPGHQVSTPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYI
QESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDIISVIIANKPEASLERQ
CVNLENEKGTKPPLQEAGSKKGRESVPTKPTPGERRYICAECGKAFSNSSNLTKHRRTHT
GEKPYVCTKCGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKHQRMHTEEAPY
QCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQRLHTGEKPYKCKE
CGKAFNHSSNFNKHHRIHTGEKPYWCHHCGKTFCSKSNLSKHQRVHTGEGEAP
Download sequence
Identical sequences A1YG26 Q9Y5A6
ENSP00000292450 ENSP00000292450 ENSP00000292450 NP_666019.1.87134 NP_666019.1.92137 XP_005250625.1.92137 XP_006716176.1.92137 XP_008967000.1.60992 XP_008967001.1.60992 XP_008967002.1.60992 XP_016868073.1.92137 9606.ENSP00000292450 gi|27544931|ref|NP_666019.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]