SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27552770|ref|NP_543137.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27552770|ref|NP_543137.2|
Domain Number 1 Region: 93-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-52
Family SPRY domain 0.001
Further Details:      
 
Weak hits

Sequence:  gi|27552770|ref|NP_543137.2|
Domain Number - Region: 275-311
Classification Level Classification E-value
Superfamily SOCS box-like 0.00445
Family SOCS box-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|27552770|ref|NP_543137.2|
Sequence length 355
Comment SPRY domain-containing SOCS box protein 3 [Homo sapiens]
Sequence
MARRPRNSRAWHFVLSAARRDADARAVALAGSTNWGYDSDGQHSDSDSDPEYSTLPPSIP
SAVPVTGESFCDCAGQSEASFCSSLHSAHRGRDCRCGEEDEYFDWVWDDLNKSSATLLSC
DNRKVSFHMEYSCGTAAIRGTKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYRH
TFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCI
GVAATKLQNKRFYPMVCSTAARSSMKVTRSCASATSLQYLCCHRLRQLRPDSGDTLEGLP
LPPGLKQVLHNKLGWVLSMSCSRRKAPVSDPQAATSAHPSSREPRPCQRKRCRRT
Download sequence
Identical sequences Q6PJ21
NP_001311010.1.87134 NP_001311010.1.92137 NP_543137.2.87134 NP_543137.2.92137 gi|27552770|ref|NP_543137.2| ENSP00000301717 ENSP00000457206 ENSP00000301717 ENSP00000301717 ENSP00000457206 9606.ENSP00000301717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]