SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27765080|ref|NP_775113.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27765080|ref|NP_775113.1|
Domain Number 1 Region: 2-154
Classification Level Classification E-value
Superfamily EF-hand 5.42e-48
Family Penta-EF-hand proteins 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|27765080|ref|NP_775113.1|
Sequence length 156
Comment calpain-3 isoform e [Homo sapiens]
Sequence
MEICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIK
AWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICC
FVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
Download sequence
Identical sequences A0A2I2ZQA3 A0A2I3H9W8 A0A2I3TVW8 A0A2J8S5P4 A0A2K5MHE0 H9KVY8
ENSMMUP00000002058 ENSCJAP00000005558 ENSCJAP00000005566 ENSP00000336840 ENSP00000348667 ENSP00000380387 ENSP00000455254 NP_775112.1.87134 NP_775112.1.92137 NP_775113.1.87134 NP_775113.1.92137 XP_003266818.1.23891 XP_003266819.1.23891 XP_004056093.1.27298 XP_008971532.1.60992 XP_008971538.1.60992 XP_016783519.1.37143 XP_016783520.1.37143 XP_016783521.1.37143 XP_016783522.1.37143 XP_018866176.1.27298 gi|27765078|ref|NP_775112.1| gi|27765080|ref|NP_775113.1| ENSP00000336840 ENSP00000380387 ENSP00000455254 hsi002005456.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]