SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27894324|ref|NP_057316.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27894324|ref|NP_057316.3|
Domain Number 1 Region: 369-541
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.75e-28
Family Toll/Interleukin receptor TIR domain 0.00079
Further Details:      
 
Domain Number 2 Region: 26-105
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000133
Family I set domains 0.043
Further Details:      
 
Domain Number 3 Region: 222-318
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000047
Family I set domains 0.024
Further Details:      
 
Domain Number 4 Region: 128-195
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000139
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|27894324|ref|NP_057316.3|
Sequence length 556
Comment interleukin-1 receptor-like 1 isoform 1 precursor [Homo sapiens]
Sequence
MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQ
ERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYS
TVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYT
CKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFG
KGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQ
YDCLALNLHGLRRHTVRLSRKNPIDHHSIYCIIAVCSVFLMLINVLVIILKMFWIEATLL
WRDIAKPYKTRNDGKLYDAYVVYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIY
GRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILI
EMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSK
IPRKASSLTPLAAQKQ
Download sequence
Identical sequences Q01638
ENSP00000233954 NYSGRC-IgSF-ILRL1_HUMAN ENSP00000233954 9606.ENSP00000233954 ENSP00000233954 gi|27894324|ref|NP_057316.3| NP_057316.3.87134 NP_057316.3.92137 XP_006712902.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]