SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27894337|ref|NP_061883.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27894337|ref|NP_061883.1|
Domain Number 1 Region: 298-376
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.53e-24
Family Intermediate filament protein, coiled coil region 0.00081
Further Details:      
 
Domain Number 2 Region: 68-104
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000115
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|27894337|ref|NP_061883.1|
Domain Number - Region: 118-210
Classification Level Classification E-value
Superfamily Prefoldin 0.0418
Family Prefoldin 0.021
Further Details:      
 
Domain Number - Region: 246-295
Classification Level Classification E-value
Superfamily Prefoldin 0.068
Family Prefoldin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|27894337|ref|NP_061883.1|
Sequence length 424
Comment keratin, type I cytoskeletal 20 [Homo sapiens]
Sequence
MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLT
GGGDLFVGNEKMAMQNLNDRLASYLEKVRTLEQSNSKLEVQIKQWYETNAPRAGRDYSAY
YRQIEELRSQIKDAQLQNARCVLQIDNAKLAAEDFRLKYETERGIRLTVEADLQGLNKVF
DDLTLHKTDLEIQIEELNKDLALLKKEHQEEVDGLHKHLGNTVNVEVDAAPGLNLGVIMN
EMRQKYEVMAQKNLQEAKEQFERQTAVLQQQVTVNTEELKGTEVQLTELRRTSQSLEIEL
QSHLSMKESLEHTLEETKARYSSQLANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIK
TRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEV
EENI
Download sequence
Identical sequences P35900
gi|27894337|ref|NP_061883.1| ENSP00000167588 ENSP00000460501 9606.ENSP00000167588 NP_061883.1.87134 NP_061883.1.92137 ENSP00000167588 ENSP00000460501 ENSP00000167588 ENSP00000460501 NYSGRC-27894337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]