SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|282165817|ref|NP_001161302.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282165817|ref|NP_001161302.1|
Domain Number 1 Region: 44-139
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 2.75e-23
Family Supernatant protein factor (SPF), C-terminal domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|282165817|ref|NP_001161302.1|
Sequence length 193
Comment transmembrane emp24 domain-containing protein 5 isoform 2 precursor [Homo sapiens]
Sequence
MGDKIWLPFPVLLLAALPPVLLPGAAGFTPSLDSDFTFTLPAGQKECFYQPMPLKASLEI
EYQVLDGAGLDIDFHLASPEGKTLVFEQRKSDGVHTVETEVGDYMFCFDNTFSTISEKVI
FFELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILDPIIKIASDVQIRLHLGIHQQHQ
VQTKQKWAHTNSA
Download sequence
Identical sequences gi|282165817|ref|NP_001161302.1| ENSP00000418992 ENSP00000418992 NP_001161302.1.87134 NP_001161302.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]