SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|282394030|ref|NP_543151.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282394030|ref|NP_543151.2|
Domain Number 1 Region: 555-827
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.69e-64
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 121-194
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 4.05e-22
Family Mib/herc2 domain 0.00077
Further Details:      
 
Domain Number 3 Region: 266-340
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 4.45e-22
Family Mib/herc2 domain 0.0011
Further Details:      
 
Domain Number 4 Region: 181-261
Classification Level Classification E-value
Superfamily RING/U-box 7.53e-20
Family ZZ domain 0.008
Further Details:      
 
Domain Number 5 Region: 1010-1065
Classification Level Classification E-value
Superfamily RING/U-box 0.00000138
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  gi|282394030|ref|NP_543151.2|
Domain Number - Region: 944-986
Classification Level Classification E-value
Superfamily RING/U-box 0.00314
Family RING finger domain, C3HC4 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|282394030|ref|NP_543151.2|
Sequence length 1070
Comment E3 ubiquitin-protein ligase MIB2 isoform 1 [Homo sapiens]
Sequence
MAGALRRGRALGSRPSGPTVSSRRSPQCPVAQEGLGARSRPRVAPRSLARCGPSSRLMGW
KPSEARGQSQSFQASGLQPRSLKAARRATGRPDRSRAARPTMDPSAHRSRAAPPNMDPDP
QAGVQVGMRVVRGVDWKWGQQDGGEGGVGTVVELGRHGSPSTPDRTVVVQWDQGTRTNYR
AGYQGAHDLLLYDNAQIGVRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHE
LAHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQGAKVVRGPDWEWGSQDGGEGKPGRVV
DIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYKDHLPRLGKPAE
LQRRVSADSQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDV
RVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVG
KVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRA
QKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKNQGRTALQVAAYLGQVELIRLLL
QARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRGFLE
VVRALCERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLH
HASLKGHALAVRKILARARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRN
RKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGAGGD
PGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEGRVLKA
LQGCAQRFRERQAGGGAAPGPRQTLGTPNTVTNLHVGAAPGPEAAECLVCSELALLVLFS
PCQHRTVCEECARRMKKCIRCQVVVSKKLRPDGSEVASAAPAPGPPRQLVEELQSRYRQM
EERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIFV
Download sequence
Identical sequences gi|282394030|ref|NP_543151.2| NP_543151.2.87134 NP_543151.2.92137 ENSP00000426103 ENSP00000428660 ENSP00000426103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]