SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|282394034|ref|NP_001164158.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282394034|ref|NP_001164158.1|
Domain Number 1 Region: 541-813
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.35e-63
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 107-180
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 3.92e-22
Family Mib/herc2 domain 0.00077
Further Details:      
 
Domain Number 3 Region: 252-326
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 4.45e-22
Family Mib/herc2 domain 0.0011
Further Details:      
 
Domain Number 4 Region: 167-247
Classification Level Classification E-value
Superfamily RING/U-box 7.42e-20
Family ZZ domain 0.008
Further Details:      
 
Domain Number 5 Region: 996-1051
Classification Level Classification E-value
Superfamily RING/U-box 0.00000134
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  gi|282394034|ref|NP_001164158.1|
Domain Number - Region: 930-972
Classification Level Classification E-value
Superfamily RING/U-box 0.00307
Family RING finger domain, C3HC4 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|282394034|ref|NP_001164158.1|
Sequence length 1056
Comment E3 ubiquitin-protein ligase MIB2 isoform 3 [Homo sapiens]
Sequence
MAGALRRGRALGSRPSGPTVSSRRSPQCPVAQEGLGARSRPRVAPRSLARCGPSSRLMGW
KPSEARGQSQSFQASGLQPRSLKAARRATGRPDRSRAAPPNMDPDPQAGVQVGMRVVRGV
DWKWGQQDGGEGGVGTVVELGRHGSPSTPDRTVVVQWDQGTRTNYRAGYQGAHDLLLYDN
AQIGVRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHELAHAFDRYETAHSR
PVTLSPRQGLPRIPLRGIFQGAKVVRGPDWEWGSQDGGEGKPGRVVDIRGWDVETGRSVA
SVTWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYKDHLPRLGKPAELQRRVSADSQPFQH
GDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHP
GALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVA
VAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLVVE
VALGNAARALDLLRRRPEQVDTKNQGRTALQVAAYLGQVELIRLLLQARAGVDLPDDEGN
TALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRGFLEVVRALCERGCDVNL
PDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKI
LARARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQA
HVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGAGGDPGPLQLLSRLQASG
LPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEGRVLKALQGCAQRFRERQAG
GGAAPGPRQTLGTPNTVTNLHVGAAPGPEAAECLVCSELALLVLFSPCQHRTVCEECARR
MKKCIRCQVVVSKKLRPDGSEVASAAPAPGPPRQLVEELQSRYRQMEERITCPICIDSHI
RLVFQCGHGACAPCGSALSACPICRQPIRDRIQIFV
Download sequence
Identical sequences gi|282394034|ref|NP_001164158.1| ENSP00000348081 NP_001164158.1.87134 NP_001164158.1.92137 ENSP00000348081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]