SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|282394038|ref|NP_001164160.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|282394038|ref|NP_001164160.1|
Domain Number 1 Region: 375-647
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.88e-64
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.48e-22
Family Mib/herc2 domain 0.00077
Further Details:      
 
Domain Number 3 Region: 66-146
Classification Level Classification E-value
Superfamily RING/U-box 4.71e-20
Family ZZ domain 0.008
Further Details:      
 
Domain Number 4 Region: 151-178,226-256
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 0.0000000109
Family Mib/herc2 domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|282394038|ref|NP_001164160.1|
Sequence length 753
Comment E3 ubiquitin-protein ligase MIB2 isoform 5 [Homo sapiens]
Sequence
MDPDPQAGVQVGMRVVRGVDWKWGQQDGGEGGVGTVVELGRHGSPSTPDRTVVVQWDQGT
RTNYRAGYQGAHDLLLYDNAQIGVRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYM
HNKHELAHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQGAKVVRGPDWEWGSQDGKPAE
LQRRVSADSQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDV
RVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVG
KVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRA
QKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKNQGRTALQVAAYLGQVELIRLLL
QARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRGFLE
VVRALCERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLH
HASLKGHALAVRKILARARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRN
RKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGAGGD
PGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEGRVLKA
LQGCAQRFRVRAQDEEVHQVPGGRQQETAPRRL
Download sequence
Identical sequences NP_001164160.1.87134 NP_001164160.1.92137 ENSP00000367984 ENSP00000367984 gi|282394038|ref|NP_001164160.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]