SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28274703|ref|NP_777561.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|28274703|ref|NP_777561.1|
Domain Number - Region: 7-97
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0318
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28274703|ref|NP_777561.1|
Sequence length 166
Comment family with sequence similarity 9, member C [Homo sapiens]
Sequence
MAAKDQLEVQVMAAQEMELAGKDPVSHEHEERKPVTETKEGDVTDEHGERGSFAETDEHT
GVDTKELEDIAADIKEHLAAKRKRIEKIAKACSEIKNRIKNVLRTTQLKRQKRDYRISLK
LPNVLEEFITDEQKDEEGDGEKEEQIKIFQEQQKRWQQDGKGTERD
Download sequence
Identical sequences A0A024RBW5 Q8IZT9
NP_777561.1.87134 NP_777561.1.92137 XP_005274517.1.92137 XP_016884810.1.92137 ENSP00000334430 9606.ENSP00000334430 gi|28274703|ref|NP_777561.1| ENSP00000334430 ENSP00000369999 ENSP00000334430 ENSP00000369999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]